The DUF663 domain within your query sequence starts at position 816 and ends at position 1108, and its E-value is 6.7e-173.

ETDPSEEESARKKHLDKKRKLKELFDAEYDEGESTYFDDLKGEMQRQAQLNQAEFEDQEDETRVQYEGFRPGMYVRIEIENIPCEFVQNFDPHYPIILGGLGNSEGTVGYVQMRIKKHRWYKKILKSRDPIIFSVGWRRFQTIPLYYIEDHNGRQRLLKYTPQHMHCGATFWGPITPQGTGFLAIQSVSGVMPEFRIAATGVVLDLDKSIKIVKKLKLTGFPFKIFKNTSFIKGMFNSALEVAKFEGAVIRTVSGIRGQIKKALRAPEGAFRASFEDKLLMSDIVFMRTWYPV
DUF663

DUF663

Protein of unknown function (DUF663)
SMART ACC:SM001362
Description:This family contains several uncharacterised eukaryotic proteins.
InterPro ACC:IPR007034
InterPro abstract:

This domain is found at the C terminus of the ribosome biogenesis protein BMS1 and TSR1 families, which may act as a molecular switch during maturation of the 40S ribosomal subunit in the nucleolus.

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 014 DUF663 domains in 4 011 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF663 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF663 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF663 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF663 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR007034
PfamDUF663