The IlGF domain within your query sequence starts at position 30 and ends at position 84, and its E-value is 2.09e-22.

ETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYC

IlGF Insulin / insulin-like growth factor / relaxin family.
SMART ACC:	SM000078
Description:	Family of proteins including insulin, relaxin, and IGFs. Insulin decreases blood glucose concentration.
InterPro ACC:	IPR016179
InterPro abstract:	This entry represents a disulphide-rich α-helical domain found in insulin [ PUBMED:12595704 ], as well as in related proteins, such as insulin-like growth factor [ PUBMED:15642270 ], relaxin [ PUBMED:1656049 … expand This entry represents a disulphide-rich α-helical domain found in insulin [ PUBMED:12595704 ], as well as in related proteins, such as insulin-like growth factor [ PUBMED:15642270 ], relaxin [ PUBMED:1656049 ] and bombyxin [ PUBMED:7473749 ]. Insulin is found in many animals, and is involved in the regulation of normal glucose homeostasis. It also has other specific physiological effects, such as increasing the permeability of cells to monosaccharides, amino acids and fatty acids, and accelerating glycolysis and glycogen synthesis in the liver [ PUBMED:6243748 ]. Insulin exerts its effects by interaction with a cell-surface receptor, which may also result in the promotion of cell growth [ PUBMED:6243748 ]. The insulin/IGF/relaxin superfamily is an ancient family of functionally diverse proteins [ PUBMED:6107857 ]. The 3D structures of a number of family members have been determined [ PUBMED:2036417 PUBMED:1319992 PUBMED:9141131 ]. The fold comprises two polypeptide chains (A and B) linked by two disulphide bonds: all share a conserved arrangement of four cysteines in their A chain, the first of which is linked by a disulfide bond to the third, while the second and fourth are linked by interchain disulfide bonds to cysteines in the B chain. This family includes: Insulin and insulin-like proteins [ PUBMED:6243748 PUBMED:503234 ] Relaxin [ PUBMED:10601981 PUBMED:8735594 ] and prorelaxin Insect prothoracicotropic hormone (bombyxin) [ PUBMED:8683595 ] Insulin-like growth factors (IGF1 and IGF2) [ PUBMED:2036417 PUBMED:1319992 ] Mammalian Leydig cell-specific insulin-like peptide (gene INSL3) Invertebrates insulin-related peptides (IRPs) [ PUBMED:30747102 ] collapse
GO component:	extracellular region (GO:0005576)
GO function:	hormone activity (GO:0005179)
Family alignment:	View the Family alignment or the Alignment consensus sequence
There are 4 123 IlGF domains in 4 108 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing IlGF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing IlGF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the IlGF domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the IlGF domain.

Protein	Description	Disease / phenotype
INS_HUMAN		OMIM:176730 : Diabetes mellitus, rare form ; MODY, one form ; Hyperproinsulinemia, familial

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a IlGF domain which could be assigned to a KEGG orthologous group, and not all proteins containing IlGF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfam	ins
PROSITE	IlGF_DOMAIN
InterPro	IPR016179