The DUF1866 domain within your query sequence starts at position 623 and ends at position 768, and its E-value is 1.04e-73.

EVEVQEVDVGARERVFQEVSSVQGPLDATVVVNLQSPTLEEKNEFPEDLRTELMQTLGNYGTIILVRINQGQMLVTFADSHSALSVLDVDGMKVKGRAVKIRPKTKDWLEGLREELLRKRDSMAPVSPTANSCLLEENFDFSSLDY
DUF1866

DUF1866

SMART ACC:SM001165
Description:This domain, found in Synaptojanin, has no known function.
InterPro ACC:IPR015047
InterPro abstract:

This domain represents the RNA recognition motif found in Synaptojanin proteins.

Synaptojanins are phosphoinositide phosphatases known to play an important role in vesicle recycling by promoting the uncoating of clathrin following synaptic vesicle uptake [ PUBMED:10931870 PUBMED:27559170 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 216 DUF1866 domains in 1 215 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF1866 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF1866 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF1866 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF1866 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR015047
PfamDUF1866