The HATPase_c domain within your query sequence starts at position 23 and ends at position 158, and its E-value is 4.57e-1.

EVIQRPANAIKEMIENCLDAKSTNIQVVVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQTFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLQAPPKPCAGNQGTLITVEDLFYN
HATPase_c

HATPase_c

Histidine kinase-like ATPases
SMART ACC:SM000387
Description:Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.
InterPro ACC:IPR003594
InterPro abstract:

This domain is found in several ATP-binding proteins, including: histidine kinase [ PUBMED:15157101 ], DNA gyrase B, topoisomerases [ PUBMED:15105144 ], heat shock protein HSP90 [ PUBMED:15292259 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 925 732 HATPase_c domains in 922 402 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing HATPase_c domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing HATPase_c domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a HATPase_c domain which could be assigned to a KEGG orthologous group, and not all proteins containing HATPase_c domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003594