The NL domain within your query sequence starts at position 1381 and ends at position 1419, and its E-value is 1.63e-15.

EVPEEPRCPRAACQAKRGDQNCDRECNTPGCGWDGGDCS
NL

NL

Domain found in Notch and Lin-12
SMART ACC:SM000004
Description:The Notch protein is essential for the proper differentiation of the Drosophila ectoderm. This protein contains 3 NL domains.
InterPro ACC:IPR000800
InterPro abstract:

The Notch domain is also called the 'DSL' domain or the Lin-12/Notch repeat (LNR). The LNR region is present only in Notch related proteins C-terminal to EGF repeats. The lin-12/Notch proteins act as transmembrane receptors for intercellular signals that specify cell fates during animal development. In response to a ligand, proteolytic cleavages release the intracellular domain of Notch, which … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 743 NL domains in 3 057 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing NL domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing NL domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the NL domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a NL domain which could be assigned to a KEGG orthologous group, and not all proteins containing NL domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamnotch
InterProIPR000800