The RPOLA_N domain within your query sequence starts at position 246 and ends at position 549, and its E-value is 7.02e-203.

EWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFT
RPOLA_N

RPOLA_N

RNA polymerase I subunit A N-terminus
SMART ACC:SM000663
Description: -
InterPro ACC:IPR006592
InterPro abstract:

The task of transcribing nuclear genes is shared between three RNA polymerases in eukaryotes: RNA polymerase (pol) I synthesizes the large rRNA, pol II synthesizes mRNA and pol III synthesizes tRNA and 5S rRNA [ PUBMED:10684922 ]. Pol I transcription is localised to discrete sites called nucleoli; these can be likened … expand

GO process:DNA-templated transcription (GO:0006351)
GO function:DNA binding (GO:0003677), DNA-directed RNA polymerase activity (GO:0003899)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 32 556 RPOLA_N domains in 32 547 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RPOLA_N domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RPOLA_N domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

Relevant references for this domain

Primary literature for the RPOLA_N domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RPOLA_N domain which could be assigned to a KEGG orthologous group, and not all proteins containing RPOLA_N domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamRNA_pol_A
InterProIPR006592