The zf-PARP domain within your query sequence starts at position 116 and ends at position 200, and its E-value is 3.99e-34.

EYAKSNRSMCKGCLEKIEKGQMRLSKKMVDPEKPQLGMIDRWYHPTCFVKKRDELGFRPEYSASQLKGFSLLSAEDKEALKKQLP
zf-PARP

zf-PARP

Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region
SMART ACC:SM001336
Description:Poly(ADP-ribose) polymerase is an important regulatory component of the cellular response to DNA damage. The amino-terminal region of Poly(ADP-ribose) polymerase consists of two PARP-type zinc fingers. This region acts as a DNA nick sensor.
InterPro ACC:IPR001510
InterPro abstract:

Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a … expand

GO function:DNA binding (GO:0003677), zinc ion binding (GO:0008270)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 565 zf-PARP domains in 2 664 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing zf-PARP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing zf-PARP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a zf-PARP domain which could be assigned to a KEGG orthologous group, and not all proteins containing zf-PARP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001510
Pfamzf-PARP