The Sec7 domain within your query sequence starts at position 17 and ends at position 206, and its E-value is 1.35e-56.

FAEGKTTGVDAGSEMGSTDILEKETTESLSNGTNSNVEAAKRLAKRLYHLDRFKRSDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFLKAFSLVGETQERERVLIHFSNRYFSCNPDTITSKDGVHCLTCAMMLLNTDLHGHNIGKKMTCQEFITNLQGVNEGGDFSKDLLKALYNSIKNEKL
Sec7

Sec7

Sec7 domain
SMART ACC:SM000222
Description:Domain named after the S. cerevisiae SEC7 gene product, which is required for proper protein transport through the Golgi. The domain facilitates guanine nucleotide exchange on the small GTPases, ARFs (ADP ribosylation factors).
InterPro ACC:IPR000904
InterPro abstract:

Protein containing this domain are highly divergent in their overall sequence, however, they share a common region of roughly 200 amino acids known as the SEC7 domain [ PUBMED:27373159 PUBMED:26765562 ]. The 3D structure of the domain displays … expand

GO process:regulation of ARF protein signal transduction (GO:0032012)
GO function:guanyl-nucleotide exchange factor activity (GO:0005085)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 12 422 Sec7 domains in 12 390 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Sec7 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Sec7 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Sec7 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Sec7 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Sec7 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000904
PfamSec7