The PTPlike_phytase domain within your query sequence starts at position 164 and ends at position 333, and its E-value is 4.33e-53.

FCVREEPVVFLRAEEDFVSYTPRDKESLHENLRDPSPGVKAENLELAIQKEIHDFAQLRDNVYHVYHNTEDLRGEPHTVAIRGEDGVCVTEEVFKRPLFLQPTYRYHRLPLPEQGAPLEAQFDAFVSVLRETPSLLPLRDNHGPLPALLFSCQSGVGRTNLGMVLGTLVM
PTPlike_phytase

PTPlike_phytase

Inositol hexakisphosphate
SMART ACC:SM001301
Description:Inositol hexakisphosphate, often called phytate, is found in abundance in seeds and acting as an inorganic phosphate reservoir. Phytases are phosphatases that hydrolyze phytate to less-phosphorylated myo-inositol derivatives and inorganic phosphate. The active-site sequence (HCXXGXGR) of the phytase identified from the gut micro-organism Selenomonas ruminantium forms a loop (P loop) at the base of a substrate binding pocket that is characteristic of protein tyrosine phosphatases (PTPs). The depth of this pocket is an important determinant of the substrate specificity of PTPs. In humans this enzyme is thought to aid bone mineralization and salvage the inositol moiety prior to apoptosis PMID:9923613.
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 612 PTPlike_phytase domains in 1 487 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PTPlike_phytase domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PTPlike_phytase domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PTPlike_phytase domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PTPlike_phytase domain which could be assigned to a KEGG orthologous group, and not all proteins containing PTPlike_phytase domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamPTPlike_phytase