The C1_4 domain within your query sequence starts at position 345 and ends at position 388, and its E-value is 3.13e-21.

FCYGCQGELKDQHVYVCTVCQNVFCVDCDVFVHDSLHCCPGCIH
C1_4

C1_4

TFIIH C1-like domain
SMART ACC:SM001047
Description:The carboxyl-terminal region of TFIIH is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C (PUBMED:10882739).
InterPro ACC:IPR004595
InterPro abstract:

The carboxyl-terminal region of TFIIH is essential for transcription activity. This regions binds three zinc atoms through two independent domains. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [ expand

GO process:DNA repair (GO:0006281)
GO function:zinc ion binding (GO:0008270)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 283 C1_4 domains in 1 282 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing C1_4 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing C1_4 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

Relevant references for this domain

Primary literature for the C1_4 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a C1_4 domain which could be assigned to a KEGG orthologous group, and not all proteins containing C1_4 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR004595
PfamC1_4