The IGc2 domain within your query sequence starts at position 316 and ends at position 380, and its E-value is 3.97e-7.

FEGQLLLLNCSVKGVPGPLKFSWYKKDMLNKETKILKSSNAEFKISQVNISDAGEYYCEANNSRR
IGc2

IGc2

Immunoglobulin C-2 Type
SMART ACC:SM000408
Description: -
InterPro ACC:IPR003598
InterPro abstract:

This entry represents a subtype of the immunoglobulin domain, and is found in a diverse range of protein families that includes glycoproteins, fibroblast growth factor receptors, vascular endothelial growth factor receptors, interleukin-6 receptor, and neural cell adhesion molecules [ PUBMED:14705960 ].

The … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 363 480 IGc2 domains in 114 582 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing IGc2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing IGc2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the IGc2 domain.

ProteinDescriptionDisease / phenotype
L1CAM_HUMANOMIM:308840 : Hydrocephalus due to aqueductal stenosis
OMIM:307000 : MASA syndrome
OMIM:303350 : Spastic paraplegia
OMIM:312900 : no description
MYPC3_HUMANOMIM:600958 : Cardiomyopathy, familial hypertrophic, 4
OMIM:115197 : no description
DCC_HUMANOMIM:120470 : Colorectal cancer
FGFR2_HUMANOMIM:176943 : Crouzon syndrome
OMIM:123500 : Jackson-Weiss syndrome
OMIM:123150 : Beare-Stevenson cutis gyrata syndrome
OMIM:123790 : Pfeiffer syndrome
OMIM:101600 : Apert syndrome
OMIM:101200 : Saethre-Chotzen syndrome
FCG2A_HUMANOMIM:146790 : {Lupus nephritis, susceptibility to}
FCG3A_HUMANOMIM:146740 : {Lupus erythematosus, systemic, susceptibility}
OMIM:152700 : Neutropenia, alloimmune neonatal ; {Viral infections, recurrent}

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a IGc2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing IGc2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003598
Pfamig