The Connexin_CCC domain within your query sequence starts at position 222 and ends at position 288, and its E-value is 9.88e-42.

FEVAFLVGQYLLYGFEVPPFFACSRQPCPHVVDCFVSRPTEKTVFLLVMYVVSCLCLLLNLCEMAHL
Connexin_CCC

Connexin_CCC

Gap junction channel protein cysteine-rich domain
SMART ACC:SM001089
Description: -
InterPro ACC:IPR019570
InterPro abstract:

This entry represents the cysteine rich domain of the connexins.

Two sets of nomenclature have been used to identify the connexins. The first, and most commonly used, classifies the connexin molecules according to molecular weight, such as connexin43 (abbreviated to Cx43), indicating a connexin of molecular weight close to 43kDa. However, studies have revealed cases where clear functional … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 824 Connexin_CCC domains in 6 799 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Connexin_CCC domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Connexin_CCC domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Connexin_CCC domain which could be assigned to a KEGG orthologous group, and not all proteins containing Connexin_CCC domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR019570
PfamConnexin_CCC