The GIYc domain within your query sequence starts at position 10 and ends at position 112, and its E-value is 1.14e-3.

FFGVYLLYCQNPRHRGRVYVGFTVNPARRVRQHNAGRKKGGAWRTSGRGPWDMVLIIHGFPSAVAALRFEWAWQHPQASRRLTHVGPRLRSEAAFAFHLRVLA
GIYc

GIYc

GIY-YIG type nucleases (URI domain)
SMART ACC:SM000465
Description: -
InterPro ACC:IPR000305
InterPro abstract:

Nucleases of the GIY-YIG family are involved in many cellular processes, including DNA repair and recombination, transfer of mobile genetic elements, and restriction of incoming foreign DNA. The GIY-YIG superfamily groups together nucleases characterised by the presence of a domain of typically ~100 amino acids, with two short motifs "GIY" and "YIG" in the N-terminal part … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 34 061 GIYc domains in 34 044 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing GIYc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing GIYc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the GIYc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a GIYc domain which could be assigned to a KEGG orthologous group, and not all proteins containing GIYc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000305
PfamExci_endo_N