The SAA domain within your query sequence starts at position 21 and ends at position 122, and its E-value is 4.22e-76.

FFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY
SAA

SAA

Serum amyloid A proteins
SMART ACC:SM000197
Description:Serum amyloid A proteins are induced during the acute-phase response. Secondary amyloidosis is characterised by the extracellular accumulation in tissues of SAA proteins. SAA proteins are apolipoproteins.
InterPro ACC:IPR000096
InterPro abstract:

The serum amyloid A (SAA) proteins comprise a family of vertebrate amphipathic α-helical apolipoproteins that associate predominantly with high density lipoproteins (HDL) [ PUBMED:7504491 PUBMED:8188253 ]. They play a role in the mobilisation … expand

GO component:extracellular region (GO:0005576)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 643 SAA domains in 624 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SAA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SAA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the SAA domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the SAA domain.

ProteinDescriptionDisease / phenotype
SAA1_HUMANOMIM:104750 : SERUM AMYLOID A1; SAA1

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SAA domain which could be assigned to a KEGG orthologous group, and not all proteins containing SAA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITESAA_DOMAIN
InterProIPR000096
PfamSAA_proteins