The PSP domain within your query sequence starts at position 286 and ends at position 338, and its E-value is 3.04e-27.

FGRFKPGVISEELQDALGVTDKSLPPFIYRMRQLGYPPGWLKEAELENSGLAL
PSP

PSP

proline-rich domain in spliceosome associated proteins
SMART ACC:SM000581
Description: -
InterPro ACC:IPR006568
InterPro abstract:

PSP is a proline-rich domain of unknown function found in spliceosome associated proteins.

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 532 PSP domains in 2 527 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PSP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PSP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:RNA- or snRNP-binding

Relevant references for this domain

Primary literature for the PSP domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the PSP domain.

ProteinDescriptionDisease / phenotype
MYF6_HUMANOMIM:159991 : Myopathy, centronuclear
OMIM:160150 : Becker muscular dystrophy modifier
OMIM:310200 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PSP domain which could be assigned to a KEGG orthologous group, and not all proteins containing PSP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006568