The IQ domain within your query sequence starts at position and ends at position , and its E-value is < 1e-12.

FIIRQRVNDEMKVNCATLLQAAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTFEPRSRFL
IQ

IQ

Short calmodulin-binding motif containing conserved Ile and Gln residues.
SMART ACC:SM000015
Description:Calmodulin-binding motif.
InterPro ACC:IPR000048
InterPro abstract:

The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K. The IQ motif, which can be present in one or more copies, serves as a binding site for different EF-hand proteins, including the essential and regulatory myosin light chains, calmodulin (CaM), CaM-like proteins and Neuromodulin [ PUBMED:1558751 expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 165 951 IQ domains in 60 575 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing IQ domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing IQ domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Ca2+-binding

Relevant references for this domain

Primary literature for the IQ domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the IQ domain.

ProteinDescriptionDisease / phenotype
MYH7_HUMANOMIM:160760 : Cardiomyopathy, familial hypertrophic, 1
OMIM:192600 : ?Central core disease, one form
MYO7A_HUMANOMIM:276903 : Usher syndrome, type 1B ; Deafness, autosomal recessive 2, neurosensory
OMIM:600060 : Deafness, autosomal dominant 11, neurosensory
OMIM:601317 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a IQ domain which could be assigned to a KEGG orthologous group, and not all proteins containing IQ domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000048