The Calx_beta domain within your query sequence starts at position 1856 and ends at position 1952, and its E-value is 1.24e-6.

FIIYSVSPNTSEDGLCVEVQEQPQTSVELVIYRTGGSLGQVMVEWRVVGGTATEGLDFMGAGDILTFAEGETKKMAILTILDDSEPEDNESILVRLV
Calx_beta

Calx_beta

Domains in Na-Ca exchangers and integrin-beta4
SMART ACC:SM000237
Description:Domain in Na-Ca exchangers and integrin subunit beta4 (and some cyanobacterial proteins)
InterPro ACC:IPR003644
InterPro abstract:

The calx-β motif is present as a tandem repeat in the cytoplasmic domains of Calx Na-Ca exchangers, which are used to expel calcium from cells. This motif overlaps domains used for calcium binding and regulation. The calx-β motif is also present in the cytoplasmic tail of mammalian integrin-beta4, which mediates the bi-directional transfer of signals across the plasma membrane, as well as in … expand

GO process:cell communication (GO:0007154)
GO component:membrane (GO:0016020)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 22 869 Calx_beta domains in 5 347 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Calx_beta domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Calx_beta domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Calx_beta domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Calx_beta domain which could be assigned to a KEGG orthologous group, and not all proteins containing Calx_beta domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003644