The eIF1a domain within your query sequence starts at position 28 and ends at position 110, and its E-value is 6.82e-46.

FKEYGQEYAQVTKMLGCGWLEAMCFDGVRRLCHIRGKLRKKVWINTSDIILIGLRDYQDNRADIILKYNPDEARSLKAYGELP
eIF1a

eIF1a

eukaryotic translation initiation factor 1A
SMART ACC:SM000652
Description: -
InterPro ACC:IPR001253
InterPro abstract:

Eukaryotic translation initiation factor A (eIF-1A) (formerly known as eiF-4C) is a protein that seems to be required for maximal rate of protein biosynthesis. It enhances ribosome dissociation into subunits and stabilises the binding of the initiator Met-tRNA to 40S ribosomal subunits [ PUBMED:7559407 ]. The archaea … expand

GO process:translational initiation (GO:0006413)
GO function:translation initiation factor activity (GO:0003743)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 369 eIF1a domains in 2 363 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing eIF1a domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing eIF1a domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation
Binding / catalysis:RNA

Relevant references for this domain

Primary literature for the eIF1a domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a eIF1a domain which could be assigned to a KEGG orthologous group, and not all proteins containing eIF1a domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001253
PfameIF-1a