The CysPc domain within your query sequence starts at position 27 and ends at position 349, and its E-value is 7.8e-139.

All catalytic sites are present in this domain, and marked green in the sequence below. Check the literature (PubMed 95361909 ) for details.

FKGQNYEAIRRACLDSGILFRDPCFPAGPDALGYDKLGPDSEKAKGVEWKRPHEFCAEPQFICEDMSRTDVCQGSLGNCWLLAAAASLTLYPRLLYRVVPPGQGFQDGYAGVFHFQLWQFGRWVDVVVDDKLPVREGKLMFVRSEQRNEFWAPLLEKAYAKLHGSYEVMRGGHMNEAFVDFTGGVGEVLYLRQNTPGVFAALRHALAKESLVGATALSDRGEIRTDEGLVKGHAYSVTGTHKMSLGFTKVRLLRLRNPWGRVEWSGPWSDSCPRWDMLPSEWRDALLVKKEDGEFWMELQDFLTHFNTVQICSLSPEVLGPSP
CysPc

CysPc

Calpain-like thiol protease family.
SMART ACC:SM000230
Description:Calpain-like thiol protease family (peptidase family C2). Calcium activated neutral protease (large subunit).
InterPro ACC:IPR001300
InterPro abstract:

This group of cysteine peptidases belong to the MEROPS peptidase family C2 (calpain family, clan CA). A type example is calpain, which is an intracellular protease involved in many important cellular functions that are regulated by calcium [ PUBMED:2539381 PUBMED:11517928 expand

GO process:proteolysis (GO:0006508)
GO function:calcium-dependent cysteine-type endopeptidase activity (GO:0004198)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 11 818 CysPc domains in 11 784 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CysPc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CysPc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the CysPc domain.

ProteinDescriptionDisease / phenotype
CAN3_HUMANOMIM:114240 : Muscular dystrophy, limb-girdle, type 2A
OMIM:253600 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CysPc domain which could be assigned to a KEGG orthologous group, and not all proteins containing CysPc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamCys_protease_2
PROSITETHIOL_PROTEASE_CYS
InterProIPR001300