The Rtt106 domain within your query sequence starts at position 806 and ends at position 896, and its E-value is 1.61e-38.

FNGAPYRSTCLLQPTSSALVNATEWPPFVVTLDEVELIHFERVQFHLKNFDMVIVYKDYSKKVTMINAIPVASLDPIKEWLNSCDLKYTEG
Rtt106

Rtt106

Histone chaperone Rttp106-like
SMART ACC:SM001287
Description:This family includes Rttp106, a histone chaperone involved in heterochromatin-mediated silencing PMID:16157874. This domain belongs to the Pleckstrin homology domain superfamily.
InterPro ACC:IPR013719
InterPro abstract:

This entry represents a domain found in the middle region of several eukaryotic proteins [ PUBMED:21454601 PUBMED:33846633 ]. It is present in various FACT (facilitates chromatin transactions) complex subunits, such as Spt16 and either Pob3 … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 948 Rtt106 domains in 3 945 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Rtt106 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Rtt106 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transport

Relevant references for this domain

Primary literature for the Rtt106 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Rtt106 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Rtt106 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR013719
PfamRtt106