The DM3 domain within your query sequence starts at position 2 and ends at position 63, and its E-value is 1.13e-11.

FPLTRPSLCKQWEAAVKRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLYIEP
DM3

DM3

Zinc finger domain in CG10631, C. elegans LIN-15B and human P52rIPK.
SMART ACC:SM000692
Description: -
InterPro ACC:IPR006612
InterPro abstract:

The THAP-type zinc finger (consensus: C-x(2,4)-C-x(35,50)-C-x(2)-H) is an ~90-residue domain restricted to animals, which is shared between the THAP family of cellular DNA-binding proteins, and transposases from mobile genomic parasites [ PUBMED:12575992 PUBMED:12717420 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 531 DM3 domains in 7 798 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DM3 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DM3 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DM3 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DM3 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006612