The MA3 domain within your query sequence starts at position 455 and ends at position 561, and its E-value is 4.45e-26.

FRRTIYLAIQSSLDFEECAHKLLKMEFAESQTKELCNMILDCCAQQRTYEKFFGLLAGRFCMLKKEYMESFESIFKEQYDTIHRLETNKLRNVAKMFAHLLYTDSLP
MA3

MA3

Domain in DAP-5, eIF4G, MA-3 and other proteins.
SMART ACC:SM000544
Description:Highly alpha-helical. May contain repeats and/or regions similar to MIF4G domains Ponting (TIBS) "Novel eIF4G domain homologues" in press
InterPro ACC:IPR003891
InterPro abstract:

This entry represents the MI domain (after MA-3 and eIF4G), it is a protein-protein interaction module of ~130 amino acids [ PUBMED:10958635 PUBMED:10973054 PUBMED:15082783 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 8 427 MA3 domains in 6 622 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing MA3 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing MA3 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the MA3 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a MA3 domain which could be assigned to a KEGG orthologous group, and not all proteins containing MA3 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003891