The LH2 domain within your query sequence starts at position 365 and ends at position 481, and its E-value is 5.92e-6.

FRYHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEV
LH2

LH2

Lipoxygenase homology 2 (beta barrel) domain
SMART ACC:SM000308
Description: -
InterPro ACC:IPR001024
InterPro abstract:

This entry represents a domain found in a variety of membrane or lipid associated proteins. It is known as the PLAT (Polycystin-1, Lipoxygenase, Alpha-Toxin) domain or LH2 (Lipoxygenase homology) domain, is found in a variety of membrane or lipid associated proteins. Structurally, this domain forms a β-sandwich composed of two sheets of four strands each [ PUBMED:10469604 expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 13 940 LH2 domains in 7 296 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LH2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LH2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the LH2 domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the LH2 domain.

ProteinDescriptionDisease / phenotype
LIPC_HUMANOMIM:151670 : Hepatic lipase deficiency
LIPL_HUMANOMIM:238600 : Hyperlipoproteinemia I ; Lipoprotein lipase deficiency ; Chylomicronemia syndrome, familial ; Combined hyperlipemia, familial

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LH2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing LH2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamlipoxygenase
InterProIPR001024
PROSITELIPOXYGENASE_1