The BRICHOS domain within your query sequence starts at position 133 and ends at position 227, and its E-value is 9.46e-30.

FSDSDPAAIIHDFEKGMTAYLDLLLGNCYLMPLNTSIVMTPKNLVELFGKLASGKYLPHTYVVREDLVAVEEIRDVSNLGIFIYQLCNNRKSFRL
BRICHOS

BRICHOS

SMART ACC:SM001039
Description:The BRICHOS domain is about 100 amino acids long. It is found in a variety of proteins implicated in dementia, respiratory distress and cancer. Its exact function is unknown; roles that have been proposed for it include (a) in targeting of the protein to the secretory pathway, (b) intramolecular chaperone-like function, and (c) assisting the specialised intracellular protease processing system (PUBMED:12114016). This C-terminal domain is embedded in the endoplasmic reticulum lumen, and binds to the N-terminal, transmembrane, SP_C, PF08999 provided that it is in non-helical conformation. Thus the Brichos domain of proSP-C is a chaperone that induces alpha-helix formation of an aggregation-prone TM region (PUBMED:19472327) .
InterPro ACC:IPR007084
InterPro abstract:

The BRICHOS domain is found in a variety of proteins implicated in dementia, respiratory distress and cancer, including BRI-2, chondromodulin-I (ChM-I), CA11, and surfactant protein C [ PUBMED:12114016 ]. Its exact function is unknown; roles that have been proposed for it include (a) targeting the protein to the secretory … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 414 BRICHOS domains in 3 356 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BRICHOS domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BRICHOS domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the BRICHOS domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BRICHOS domain which could be assigned to a KEGG orthologous group, and not all proteins containing BRICHOS domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamBRICHOS
InterProIPR007084