The ZnF_GATA domain within your query sequence starts at position 210 and ends at position 260, and its E-value is 4.36e-18.

FSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRL
ZnF_GATA

ZnF_GATA

zinc finger binding to DNA consensus sequence [AT]GATA[AG]
SMART ACC:SM000401
Description: -
InterPro ACC:IPR000679
InterPro abstract:

This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [ PUBMED:2249770 ] in the regulatory regions of genes. They are consequently termed GATA-binding … expand

GO process:regulation of DNA-templated transcription (GO:0006355)
GO function:sequence-specific DNA binding (GO:0043565)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 16 722 ZnF_GATA domains in 13 069 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ZnF_GATA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ZnF_GATA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:DNA-binding

Relevant references for this domain

Primary literature for the ZnF_GATA domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the ZnF_GATA domain.

ProteinDescriptionDisease / phenotype
GATA1_HUMANOMIM:305371 : Dyserythropoietic anemia with thrombocytopenia

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ZnF_GATA domain which could be assigned to a KEGG orthologous group, and not all proteins containing ZnF_GATA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEGATA_ZN_FINGER
InterProIPR000679
PfamGATA