The SAM_PNT domain within your query sequence starts at position 87 and ends at position 170, and its E-value is 3.35e-43.

FSGFQKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVNVNLHQFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKEN
SAM_PNT

SAM_PNT

SAM / Pointed domain
SMART ACC:SM000251
Description:A subfamily of the SAM domain
InterPro ACC:IPR003118
InterPro abstract:

The highly conserved PNT (or Pointed) domain is found within a subset of the Ets transcription factors, including mammalian Ets-1, Ets-2, Erg, Fli-1, GABPalpha, and Tel, as well as Drosophila Pnt-P2 and Yan. The PNT domain is structurally related to the larger group of SAM domains through a common tertiary arrangement of four α-helices. A role in protein-protein association has been established … expand

GO function:sequence-specific DNA binding (GO:0043565)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 576 SAM_PNT domains in 5 570 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SAM_PNT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SAM_PNT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SAM_PNT domain which could be assigned to a KEGG orthologous group, and not all proteins containing SAM_PNT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003118