The FANCL_C domain within your query sequence starts at position 298 and ends at position 366, and its E-value is 7.55e-44.

FSMDCGICYARHLNGAIPDQVCNNPQCGQPFHEICLYEWLRGLSTSRQSFNVFFGDCPYCSKPITLKMS
FANCL_C

FANCL_C

FANCL C-terminal domain
SMART ACC:SM001197
Description:This domain is found at the C-terminus of the Fancl protein in humans which is the putative E3 ubiquitin ligase subunit of the FA complex (Fanconi anaemia). Eight subunits of the Fanconi anaemia gene products form a multisubunit nuclear complex which is required for mono-ubiquitination of a downstream FA protein, FANCD2.
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 701 FANCL_C domains in 701 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FANCL_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FANCL_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Interaction (with the environment)

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FANCL_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing FANCL_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamFANCL_C