The CA domain within your query sequence starts at position 369 and ends at position 450, and its E-value is 1.08e-24.

FSVSDLDSGENGKVSCSIQDDLPFFLKPSGENFYTLLSQKPLDRESVAEYNITITVADMGSPILKTQVNLTVQVSDINDNAP
CA

CA

Cadherin repeats.
SMART ACC:SM000112
Description:Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium.
InterPro ACC:IPR002126
InterPro abstract:

This entry represents the extracellular repeated domains found in cadherins and related proteins.

Cadherins are a group of transmembrane proteins that serve as the major adhesion molecules located within adherens junctions. They can regulate cell-cell adhesion through their extracellular domain and their cytosolic domains connect to the actin cytoskeleton by binding to catenins [ expand

GO process:homophilic cell adhesion via plasma membrane adhesion molecules (GO:0007156)
GO component:membrane (GO:0016020)
GO function:calcium ion binding (GO:0005509)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 347 616 CA domains in 53 016 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the CA domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the CA domain.

ProteinDescriptionDisease / phenotype
CADH1_HUMANOMIM:192090 : Endometrial carcinoma ; Ovarian carcinoma ; Breast cancer, lobular ; Gastric cancer, familial diffuse
OMIM:137215 : {Listeria monocytogenes, susceptibility to}

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CA domain which could be assigned to a KEGG orthologous group, and not all proteins containing CA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITECA_DOMAIN
InterProIPR002126
Pfamcadherin