The Cyt-b5 domain within your query sequence starts at position 73 and ends at position 171, and its E-value is 6.2e-25.

FTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLSDWDSQFTFKYHHVGKLL
Cyt-b5

Cyt-b5

Cytochrome b5-like Heme/Steroid binding domain
SMART ACC:SM001117
Description:This family includes heme binding domains from a diverse range of proteins. This family also includes proteins that bind to steroids. The family includes progesterone receptors such as O00264 ((PUBMED:9705155),(PUBMED:8774719)). Many members of this subfamily are membrane anchored by an N-terminal transmembrane alpha helix. This family also includes a domain in some chitin synthases. There is no known ligand for this domain in the chitin synthases.
InterPro ACC:IPR001199
InterPro abstract:

Cytochrome b5 is a membrane-bound hemoprotein which acts as an electron carrier for several membrane-bound oxygenases [ PUBMED:2752049 ]. There are two homologous forms of b5, one found in microsomes and one found in the outer membrane of mitochondria. Two conserved histidine residues serve as axial ligands for the heme … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 28 640 Cyt-b5 domains in 27 276 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Cyt-b5 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Cyt-b5 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Cyt-b5 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Cyt-b5 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001199
PfamCyt-b5