The NEBU domain within your query sequence starts at position 1918 and ends at position 1948, and its E-value is 7.58e-7.

FTSVVDTPEHLRTTKVNKQISDILYKLEYNK
NEBU

NEBU

SMART ACC:SM000227
Description:The Nebulin repeat is present also in Las1. Tandem arrays of these repeats are known to bind actin.
InterPro ACC:IPR000900
InterPro abstract:

The nebulin-like motif or nebulin repeat is a tandemly repeated actin-binding module of about 35 amino acids. The repeat is named after the nebulin protein, which is a large protein specific for vertebrate skeletal muscle that may regulate the length of thin filaments. Nebulin contains about 185 copies of the repeat and those in the central part of nebulin are organised into seven-module super-repeats … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 162 486 NEBU domains in 3 176 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing NEBU domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing NEBU domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a NEBU domain which could be assigned to a KEGG orthologous group, and not all proteins containing NEBU domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

InterProIPR000900
PfamNebulin_repeat