The DUSP domain within your query sequence starts at position 699 and ends at position 782, and its E-value is 4.4e-17.

FYISRQWLNKFKTFAEPGPISNNDFLCIHGGIPPRKASYIEDLVLMLPQNIWDNLYSRYGGGPAVNHLYICHTCQIELEKIEKR
DUSP

DUSP

Domain in ubiquitin-specific proteases.
SMART ACC:SM000695
Description: -
InterPro ACC:IPR006615
InterPro abstract:

Deubiquitinating enzymes (DUB) form a large family of cysteine protease that can deconjugate ubiquitin or ubiquitin-like proteins from ubiquitin-conjugated proteins. All DUBs contain a catalytic domain surrounded by one or more subdomains, some of which contribute to target recognition. The ~120-residue DUSP (domain present in ubiquitin-specific proteases) domain is one of these specific subdomains. … expand

GO function:cysteine-type deubiquitinase activity (GO:0004843)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 789 DUSP domains in 4 820 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUSP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUSP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUSP domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUSP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006615