The eIF2B_5 domain within your query sequence starts at position 13 and ends at position 128, and its E-value is 7.62e-67.

FYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYR
eIF2B_5

eIF2B_5

domain present in translation initiation factor eIF2B and eIF5
SMART ACC:SM000653
Description: -
InterPro ACC:IPR002735
InterPro abstract:

The beta subunit of archaeal and eukaryotic translation initiation factor 2 (IF2beta) and the N-terminal domain of translation initiation factor 5 (IF5) show significant sequence homology [ PUBMED:11980477 ]. Archaeal IF2beta contains two independent structural domains: an N-terminal mixed α/β core domain (topological … expand

GO process:translational initiation (GO:0006413)
GO function:translation initiation factor activity (GO:0003743)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 884 eIF2B_5 domains in 2 881 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing eIF2B_5 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing eIF2B_5 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation
Binding / catalysis:RNA

Relevant references for this domain

Primary literature for the eIF2B_5 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a eIF2B_5 domain which could be assigned to a KEGG orthologous group, and not all proteins containing eIF2B_5 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfameIF5_eIF2B
InterProIPR002735