The DUF1767 domain within your query sequence starts at position 6 and ends at position 88, and its E-value is 4.85e-24.

GAALSQAGWYLSDEGVEACTSSPGKGSINDIILIALNTDLRTIGKKFLPSDINGGKVEKLEGPCVLQIQKVRNVAAPKDNEES
DUF1767

DUF1767

SMART ACC:SM001161
Description:Eukaryotic domain of unknown function. This domain is found to the N-terminus of the nucleic acid binding domain.
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 940 DUF1767 domains in 1 938 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF1767 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF1767 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF1767 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF1767 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDUF1767