The Ribosomal_L2 domain within your query sequence starts at position 11 and ends at position 90, and its E-value is 5.53e-33.

GAGSVFRAHVKHRKGAARLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAEGIHTGQFVYC
Ribosomal_L2

Ribosomal_L2

Ribosomal Proteins L2, RNA binding domain
SMART ACC:SM001383
Description: -
InterPro ACC:IPR022666
InterPro abstract:
This entry represents the N-terminal RNA-binding domain of the large ribosomal subunit protein uL2.

Ribosomal protein uL2 is one of the proteins from the large ribosomal subunit. The best conserved region is located in the C-terminal section of these proteins. In Escherichia coli, uL2 is known to bind to the 23S rRNA and to have peptidyltransferase activity. It belongs to a family of ribosomal … expand

GO process:translation (GO:0006412)
GO component:ribosome (GO:0005840)
GO function:structural constituent of ribosome (GO:0003735)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 22 443 Ribosomal_L2 domains in 22 430 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Ribosomal_L2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Ribosomal_L2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation
Binding / catalysis:RNA binding domain

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Ribosomal_L2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Ribosomal_L2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamRibosomal_L2
InterProIPR022666