The IG_FLMN domain within your query sequence starts at position 2229 and ends at position 2320, and its E-value is 1.56e-38.

GAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASP
IG_FLMN

IG_FLMN

Filamin-type immunoglobulin domains
SMART ACC:SM000557
Description:These form a rod-like structure in the actin-binding cytoskeleton protein, filamin. The C-terminal repeats of filamin bind beta1-integrin (CD29).
InterPro ACC:IPR001298
InterPro abstract:

The many different actin cross-linking proteins share a common architecture, consisting of a globular actin-binding domain and an extended rod. Whereas their actin-binding domains consist of two calponin homology domains (see IPR001715 ), their rods fall into three families.

The rod domain of the family … expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 64 366 IG_FLMN domains in 8 225 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing IG_FLMN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing IG_FLMN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the IG_FLMN domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a IG_FLMN domain which could be assigned to a KEGG orthologous group, and not all proteins containing IG_FLMN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001298