The SMI1_KNR4 domain within your query sequence starts at position 116 and ends at position 246, and its E-value is 3.02e-5.

GAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFIIGATFTDWFTS
SMI1_KNR4

SMI1_KNR4

SMI1 / KNR4 family
SMART ACC:SM000860
Description:Proteins in this family are involved in the regulation of 1,3-beta-glucan synthase activity and cell-wall formation.
InterPro ACC:IPR018958
InterPro abstract:

This domain is found in the yeast cell wall assembly regulator Smi1 (also known as Knr4) [ PUBMED:7937796 PUBMED:8289782 ].

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 15 672 SMI1_KNR4 domains in 15 452 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SMI1_KNR4 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SMI1_KNR4 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Replication

Relevant references for this domain

Primary literature for the SMI1_KNR4 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SMI1_KNR4 domain which could be assigned to a KEGG orthologous group, and not all proteins containing SMI1_KNR4 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR018958
PfamSMI1_KNR4