The GHA domain within your query sequence starts at position 34 and ends at position 120, and its E-value is 3.31e-57.

GCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNARVENHTECHCSTCYYHKS
GHA

GHA

Glycoprotein hormone alpha chain homologues.
SMART ACC:SM000067
Description:Also called gonadotropins. Glycoprotein hormones consist of two glycosylated chains (alpha and beta) of similar topology.
InterPro ACC:IPR000476
InterPro abstract:

Glycoprotein hormones [ PUBMED:6267989 PUBMED:1445230 ] (or gonadotropins) are a family of proteins, which include the mammalian hormones follitropin (FSH), lutropin (LSH), thyrotropin(TSH) placental chorionic gonadotropins hCG and eCG [ expand

GO component:extracellular region (GO:0005576)
GO function:hormone activity (GO:0005179)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 358 GHA domains in 358 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing GHA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing GHA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the GHA domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a GHA domain which could be assigned to a KEGG orthologous group, and not all proteins containing GHA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000476
PROSITEGHA_DOMAIN
Pfamhormone6