The FA58C domain within your query sequence starts at position 110 and ends at position 266, and its E-value is 3.68e-44.

GCSTQLGMEGGAIADSQISASSVYMGFMGLQRWGPELARLYRTGIVNAWTASNYDSKPWIQVNLLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRKFEFIQDESGGDKEFLGNLDNNSLKVNMFNPTLEAQYIKLYPVSCHRGCTLRFELLGC
FA58C

FA58C

Coagulation factor 5/8 C-terminal domain, discoidin domain
SMART ACC:SM000231
Description:Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.
InterPro ACC:IPR000421
InterPro abstract:

Blood coagulation factors V and VIII contain a C-terminal, twice repeated, domain of about 150 amino acids, which is called F5/8 type C, FA58C, or C1/C2- like domain. In the Dictyostelium discoideum (Slime mold) cell adhesion protein discoidin, a related domain, named discoidin I-like domain, DLD, or DS, has been found which shares a common C-terminal region of about 110 amino acids with the … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 23 298 FA58C domains in 16 898 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FA58C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FA58C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the FA58C domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the FA58C domain.

ProteinDescriptionDisease / phenotype
FA8_HUMANOMIM:306700 : Hemophilia A
XLRS1_HUMANOMIM:312700 : Retinoschisis

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FA58C domain which could be assigned to a KEGG orthologous group, and not all proteins containing FA58C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamF5_F8_type_C
InterProIPR000421
PROSITEFA58C_2