The SMC_hinge domain within your query sequence starts at position 1721 and ends at position 1848, and its E-value is 1.64e-15.

GDILGKIAHLAQIEDDRAAMVISWHLASDMDCVVTLTTDAARAIYDETQGRQQVLPLDSIYRKTLPDWKRPLPHFRNGKLHFKPFGNPVFARDLLTFPDNIEHCETVFGMLLGDTIILDNLDAANHYR
SMC_hinge

SMC_hinge

SMC proteins Flexible Hinge Domain
SMART ACC:SM000968
Description:This entry represents the hinge region of the SMC (Structural Maintenance of Chromosomes) family of proteins. The hinge region is responsible for formation of the DNA interacting dimer. It is also possible that the precise structure of it is an essential determinant of the specificity of the DNA-protein interaction (PUBMED:12411491).
InterPro ACC:IPR010935
InterPro abstract:

This entry represents the hinge region of the SMC (Structural Maintenance of Chromosomes) family of proteins. The hinge region is responsible for formation of the DNA interacting dimer. It is also possible that its precise structure is an essential determinant of the specificity of the DNA-protein interaction [ PUBMED:12411491 expand

GO process:chromosome organization (GO:0051276)
GO component:chromosome (GO:0005694)
GO function:protein binding (GO:0005515), ATP binding (GO:0005524)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 21 778 SMC_hinge domains in 21 762 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SMC_hinge domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SMC_hinge domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transport

Relevant references for this domain

Primary literature for the SMC_hinge domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SMC_hinge domain which could be assigned to a KEGG orthologous group, and not all proteins containing SMC_hinge domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamSMC_hinge
InterProIPR010935