The ELFV_dehydrog domain within your query sequence starts at position 2 and ends at position 139, and its E-value is 5.91e-31.

GDKTFVVQGFGNVGLHSMRYLHRFGAKCVGVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKVYEGSILEADCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNIMVIPGASEKDIVHSG
ELFV_dehydrog

ELFV_dehydrog

Glutamate/Leucine/Phenylalanine/Valine dehydrogenase
SMART ACC:SM000839
Description:Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related. They contain a Gly-rich region containing a conserved Lys residue, which has been implicated in the catalytic activity, in each case a reversible oxidative deamination reaction.
InterPro ACC:IPR006096
InterPro abstract:

Glutamate, leucine, phenylalanine, valine and tryptophan dehydrogenases are structurally and functionally related. They contain a Gly-rich region containing a conserved Lys residue, which has been implicated in the catalytic activity, in each case a reversible oxidative deamination reaction.

Glutamate dehydrogenases ( EC:1.4.1.2 expand

GO process:amino acid metabolic process (GO:0006520)
GO function:oxidoreductase activity (GO:0016491)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 30 530 ELFV_dehydrog domains in 30 511 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ELFV_dehydrog domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ELFV_dehydrog domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the ELFV_dehydrog domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ELFV_dehydrog domain which could be assigned to a KEGG orthologous group, and not all proteins containing ELFV_dehydrog domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamELFV_dehydrog
InterProIPR006096