The PUA domain within your query sequence starts at position 112 and ends at position 203, and its E-value is 1.96e-4.

GEVIVGAQCGNAVLRGAHVYVPGIVSASKFMKAGDVISVYSDINGKCKKGAKEFDGTKVFLGNGISELSRKDIFNGLPDLKGIGIRMTEPIY
PUA

PUA

Putative RNA-binding Domain in PseudoUridine synthase and Archaeosine transglycosylase
SMART ACC:SM000359
Description: -
InterPro ACC:IPR002478
InterPro abstract:

The PUA (PseudoUridine synthase and Archaeosine transglycosylase) domain was named after the proteins in which it was first found [ PUBMED:10093218 ]. PUA is a highly conserved RNA-binding motif found in a wide range of archaeal, bacterial and eukaryotic proteins, including enzymes that catalyse tRNA and rRNA post-transcriptional … expand

GO function:RNA binding (GO:0003723)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 27 311 PUA domains in 27 309 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PUA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PUA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:RNA-binding

Relevant references for this domain

Primary literature for the PUA domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the PUA domain.

ProteinDescriptionDisease / phenotype
DKC1_HUMANOMIM:300126 : Dyskeratosis congenita-1
OMIM:305000 : Hoyeraal-Hreidarsson syndrome
OMIM:300240 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PUA domain which could be assigned to a KEGG orthologous group, and not all proteins containing PUA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002478