The ChtBD2 domain within your query sequence starts at position 425 and ends at position 473, and its E-value is 2.06e-6.

GFCADKADGLYPVADDRNAFWQCINGITYQQHCQAGLVFDTSCNCCNWP
ChtBD2

ChtBD2

Chitin-binding domain type 2
SMART ACC:SM000494
Description: -
InterPro ACC:IPR002557
InterPro abstract:

This entry represents a chitin binding domain [ PUBMED:10770921 ]. It is found in the Peritrophin-A chitin binding proteins, particularly the peritrophic matrix proteins of insects and animal chitinases [ PUBMED:9651363 PUBMED:8621536 expand

GO component:extracellular region (GO:0005576)
GO function:chitin binding (GO:0008061)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 46 118 ChtBD2 domains in 18 434 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ChtBD2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ChtBD2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ChtBD2 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ChtBD2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing ChtBD2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002557
PfamChitin_bind_2