The C4 domain within your query sequence starts at position 1444 and ends at position 1553, and its E-value is 3.77e-70.

GFIFTRHSQTTAIPSCPEGTQPLYSGFSLLFVQGNKRAHGQDLGTLGSCLQRFTTMPFLFCNINNVCNFASRNDYSYWLSTPALMPMDMAPISGRALEPYISRCTVCEGP
C4

C4

C-terminal tandem repeated domain in type 4 procollagens
SMART ACC:SM000111
Description:Duplicated domain in C-terminus of type 4 collagens. Mutations in alpha-5 collagen IV are associated with X-linked Alport syndrome.
InterPro ACC:IPR001442
InterPro abstract:

Collagens are major components of the extracellular matrices of all metazoan life and play crucial roles in developmental processes and tissue homeostasis. Collagens are composed of three polypeptide chains (alpha chains) that fold together to form the characteristic triple helical collagenous domain. Some types of triple helical protomers contain genetically identical alpha chains forming homotrimers … expand

GO component:collagen trimer (GO:0005581)
GO function:extracellular matrix structural constituent (GO:0005201)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 781 C4 domains in 2 900 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing C4 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing C4 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the C4 domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the C4 domain.

ProteinDescriptionDisease / phenotype
CO4A4_HUMANOMIM:120131 : Alport syndrome, autosomal recessive
OMIM:203780 : Hematuria, familial benign
CO4A5_HUMANOMIM:303630 : Alport syndrome
OMIM:301050 : no description
CO4A3_HUMANOMIM:120070 : Alport syndrome, autosomal recessive
OMIM:203780 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a C4 domain which could be assigned to a KEGG orthologous group, and not all proteins containing C4 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001442