The PTPc domain within your query sequence starts at position 69 and ends at position 343, and its E-value is 1.76e-136.

All catalytic sites are present in this domain, and marked green in the sequence below. Check the literature (PubMed 98221181 ) for details.

GFSEDFEEVQRCTADMNITAEHSNHPDNKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIIMITNLVEKGRRKCDQYWPTENTEEYGNIIVTLKSTKVHACYTVRRLSVRNTKVKKGQKGNPKGRQNERTVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARMPDMGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAIL
PTPc

PTPc

Protein tyrosine phosphatase, catalytic domain
SMART ACC:SM000194
Description: -
InterPro ACC:IPR000242
InterPro abstract:

This entry represents the PTPase domain found in several tyrosine-specific protein phosphatases (PTPases).

Structurally, all known receptor PTPases, are made up of a variable length extracellular domain, followed by a transmembrane region and a C-terminal catalytic cytoplasmic domain. Some of the receptor PTPases contain fibronectin type III (FN-III) repeats, immunoglobulin-like domains … expand

GO process:protein dephosphorylation (GO:0006470)
GO function:protein tyrosine phosphatase activity (GO:0004725)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 37 989 PTPc domains in 29 134 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PTPc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PTPc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Protein tyrosine phosphatase

Relevant references for this domain

Primary literature for the PTPc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PTPc domain which could be assigned to a KEGG orthologous group, and not all proteins containing PTPc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITETYR_PHOSPHATASE_PTP
InterProIPR000242
PfamY_phosphatase