The DM15 domain within your query sequence starts at position 52 and ends at position 93, and its E-value is 6.61e-18.

GFTQQLYHRYRRKCLSERKRLGIGQSQEMNTLFRFWSFFLRD
DM15

DM15

Tandem repeat in fly CG14066 (La related protein), human KIAA0731 and worm R144.7. Unknown function.
SMART ACC:SM000684
Description: -
InterPro ACC:IPR006607
InterPro abstract:

This repeat is found in a highly conserved C-terminal region of La-related protein 1 (LARP1). LARP1 is implicated in the stability, localisation, and translational efficiency of mRNAs required for cell development, migration, division, and general translation [ PUBMED:23711370 PUBMED:20430826 expand

GO process:mRNA stabilization (GO:0048255)
GO function:RNA cap binding (GO:0000339)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 521 DM15 domains in 1 532 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DM15 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DM15 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DM15 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DM15 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006607