The PAX domain within your query sequence starts at position 16 and ends at position 140, and its E-value is 2.3e-96.

GHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINRIIR
PAX

PAX

Paired Box domain
SMART ACC:SM000351
Description: -
InterPro ACC:IPR001523
InterPro abstract:

The paired domain is an approximately 126 amino acid DNA-binding domain, which is found in eukaryotic transcription regulatory proteins involved in embryogenesis. The domain was originally described as the 'paired box' in the Drosophila protein paired (prd) [ PUBMED:2877747 PUBMED:3123319 expand

GO process:regulation of DNA-templated transcription (GO:0006355)
GO function:DNA binding (GO:0003677)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 270 PAX domains in 7 258 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PAX domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PAX domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PAX domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the PAX domain.

ProteinDescriptionDisease / phenotype
PAX2_HUMANOMIM:167409 : Optic nerve coloboma with renal disease
OMIM:120330 : no description
PAX3_HUMANOMIM:193500 : Waardenburg syndrome, type I ; Waardenburg syndrome, type III
OMIM:148820 : Rhabdomyosarcoma, alveolar
OMIM:268220 : Craniofacial-deafness-hand syndrome
OMIM:122880 : no description
PAX6_HUMANOMIM:106210 : Aniridia ; Peters anomaly
OMIM:603807 : Cataract, congenital, with late-onset corneal dystrophy ; Foveal hypoplasia, isolated
OMIM:136520 : Ectopia pupillae
OMIM:129750 : Keratitis
OMIM:148190 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PAX domain which could be assigned to a KEGG orthologous group, and not all proteins containing PAX domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamPAX
PROSITEPAIRED_BOX
InterProIPR001523