The MoCF_biosynth domain within your query sequence starts at position 19 and ends at position 180, and its E-value is 7.52e-24.

GIIIVGDEILKGHTQDTNTYFLCRTLRSLGVQVCRVSVVPDEVATIASEVNSFSRRFTHVLTAGGIGPTHDDVTFEAVAQAFGEELKPHPELQAAIKTLGGEGWEKLSMVPSSARLHYGTDPRTGHPFRFPLVSVRNVYLFPGIPELLRRVLEGLKGLFQNT
MoCF_biosynth

MoCF_biosynth

Probable molybdopterin binding domain
SMART ACC:SM000852
Description:This domain is found a variety of proteins involved in biosynthesis of molybdopterin cofactor. The domain is presumed to bind molybdopterin. The structure of this domain is known, and it forms an alpha/beta structure. In the known structure of Gephyrin this domain mediates trimerisation.
InterPro ACC:IPR001453
InterPro abstract:

MoaB/Mog domain, also known as Cnx1G domain, is found in the bacterial molybdenum cofactor (Moco) biosynthesis protein MoaB/Mog and N-terminal of the eukaryotic MoCF biosynthesis proteins, such as the Drosophila protein cinnamon, the Arabidopsis protein cnx1 and the mammal protein gephyrin [ PUBMED:19675644 ]. These … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 65 645 MoCF_biosynth domains in 63 910 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing MoCF_biosynth domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing MoCF_biosynth domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the MoCF_biosynth domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a MoCF_biosynth domain which could be assigned to a KEGG orthologous group, and not all proteins containing MoCF_biosynth domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001453
PfamMoCF_biosynth