The TPK_B1_binding domain within your query sequence starts at position 119 and ends at position 186, and its E-value is 5.12e-17.

GKHRLHVDTGMEGSWCGLIPVGQPCNQVTTTGLKWNLTNDVLGFGTLVSTSNTYDGSGLVTVETDHPL
TPK_B1_binding

TPK_B1_binding

Thiamin pyrophosphokinase, vitamin B1 binding domain
SMART ACC:SM000983
Description:Thiamin pyrophosphokinase (TPK) catalyzes the transfer of a pyrophosphate group from ATP to vitamin B1 (thiamin) to form the coenzyme thiamin pyrophosphate (TPP). Thus, TPK is important for the formation of a coenzyme required for central metabolic functions. The structure of thiamin pyrophosphokinase suggest that the enzyme may operate by a mechanism of pyrophosphoryl transfer similar to those described for pyrophosphokinases functioning in nucleotide biosynthesis (PUBMED:11435118).
InterPro ACC:IPR007373
InterPro abstract:

Thiamin pyrophosphokinase (TPK, EC:2.7.6.2 ) catalyzes the transfer of a pyrophosphate group from ATP to vitamin B1 (thiamin) to form the coenzyme thiamin pyrophosphate (TPP). Thus, TPK is important for the formation of a coenzyme required for central metabolic functions. The structure of thiamin pyrophosphokinase suggest that … expand

GO process:thiamine diphosphate biosynthetic process (GO:0009229)
GO function:thiamine binding (GO:0030975)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 992 TPK_B1_binding domains in 7 991 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TPK_B1_binding domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TPK_B1_binding domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TPK_B1_binding domain which could be assigned to a KEGG orthologous group, and not all proteins containing TPK_B1_binding domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamTPK_B1_binding
InterProIPR007373