The Jacalin domain within your query sequence starts at position 32 and ends at position 159, and its E-value is 5.49e-2.

GKHSCTSAPEGKNITSIRVFLKGRLIVGIQLNYDDNKDGQVYGSTAGKEMVARLSKEEHIIAAQGTYTPSALTQIIFTTNQPRQLMVGYYVGNSEYSSFPNDPSHVLKGACVSWRAGGIKSILFLWGS
Jacalin

Jacalin

Jacalin-like lectin domain
SMART ACC:SM000915
Description:This entry represents a mannose-binding lectin domain with a beta-prism fold consisting of three 4-stranded beta-sheets, with an internal pseudo 3-fold symmetry. Some lectins in this group stimulate distinct T- and B- cell functions, such as Jacalin, which binds to the T-antigen and acts as an agglutinin. This domain is found in 1 to 6 copies in lectins. The domain is also found in the salt-stress induced protein from rice and an animal prostatic spermine-binding protein.
InterPro ACC:IPR001229
InterPro abstract:

The jacalin-like mannose-binding lectin domain has a β-prism fold consisting of three 4-stranded β-sheets, with an internal pseudo 3-fold symmetry. Some proteins with this domain stimulate distinct T- and B- cell functions, such as the plant lectin jacalin, which binds to the T-antigen and acts as an agglutinin. The domain can occur in tandem-repeat arrangements with up to six copies, and in architectures … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 537 Jacalin domains in 4 554 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Jacalin domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Jacalin domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Interaction (with the environment)

Relevant references for this domain

Primary literature for the Jacalin domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Jacalin domain which could be assigned to a KEGG orthologous group, and not all proteins containing Jacalin domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamJacalin
InterProIPR001229