The c-clamp domain within your query sequence starts at position 536 and ends at position 566, and its E-value is 1.55e-13.

GKKCRKVYGMENRDMWCTACRWKKACQRFID
c-clamp

c-clamp

SMART ACC:SM001366
Description:Sequence-specific DNA binding domain in TCFs.
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 843 c-clamp domains in 2 828 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing c-clamp domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing c-clamp domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a c-clamp domain which could be assigned to a KEGG orthologous group, and not all proteins containing c-clamp domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain